DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk1c9

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_786935.1 Gene:Klk1c9 / 292868 RGDID:727805 Length:259 Species:Rattus norvegicus


Alignment Length:244 Identity:79/244 - (32%)
Similarity:117/244 - (47%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITS 160
            |:|||.....|..||...::  |...|||.|:...:|::||||..|    ..||:.| .:..:..
  Rat    24 RVVGGYNCETNSQPWQVAVI--GTTFCGGVLIDPSWVITAAHCYSK----NYRVLLG-RNNLVKD 81

  Fly   161 ESQAIQRAVTAVIKHKSFDP-----------DTYNNDIALLRLRKPISFSKIIKPICLPRYNYDP 214
            |..|.:|.|:...:|..:.|           ..:|||:.||.|.||...:..:|.|.||  ..:|
  Rat    82 EPFAQRRLVSQSFQHPDYIPVFMRNHTRQRAYDHNNDLMLLHLSKPADITGGVKVIDLP--TEEP 144

  Fly   215 -AGRIGTVVGWGRTSEGG-ELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGR--PSMDSC 275
             .|.|....|||.|:... :|...:..|.:.::|..:| .:.||:.. |...||||.  ...|:|
  Rat   145 KVGSICLASGWGMTNPSEMKLSHDLQCVNIHLLSNEKC-IETYKNIE-TDVTLCAGEMDGGKDTC 207

  Fly   276 QGDSGGPLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIK 323
            .|||||| |:.:||   :.|:.|.| ..|.:...|.:|:::.||..|||
  Rat   208 TGDSGGP-LICDGV---LQGLTSGGATPCAKPKTPAIYAKLIKFTSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 78/243 (32%)
Klk1c9NP_786935.1 Tryp_SPc 24..251 CDD:214473 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.