DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk7

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:240 Identity:78/240 - (32%)
Similarity:127/240 - (52%) Gaps:26/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITS 160
            ||:.|.......:||...::...:.||||.|:.:.:||:||||.           .|.:...:.|
  Rat    25 RIIDGYKCKEGSHPWQVALLKGDQLHCGGVLVGESWVLTAAHCK-----------MGQYTVHLGS 78

  Fly   161 ---ESQAIQR-AVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTV 221
               |.|:.|| ..:...:|..:...|:.|||.|:::.||:..|..::.:.||.: .:|.|.:.||
  Rat    79 DKIEDQSAQRIKASRSFRHPGYSTRTHVNDIMLVKMDKPVKMSDKVQKVKLPDH-CEPPGTLCTV 142

  Fly   222 VGWG-RTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRP--SMDSCQGDSGGPL 283
            .||| .||.....||.:....|.::|..||: :.||.. :..:|||||.|  ..::|.|||||||
  Rat   143 SGWGTTTSPDVTFPSDLMCSDVKLISSQECK-KVYKDL-LGKTMLCAGIPDSKTNTCNGDSGGPL 205

  Fly   284 LLSNGVKYFIVGIVSWGV-GCGREGYPGVYSRVSKFIPWIKSNLE 327
            :.::.::    |:||||. .||:...||||::|.|:..|::..::
  Rat   206 VCNDTLQ----GLVSWGTYPCGQPNDPGVYTQVCKYQRWLEDTMK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 77/235 (33%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 77/232 (33%)
Tryp_SPc 26..244 CDD:238113 77/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.