DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk13

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:261 Identity:92/261 - (35%)
Similarity:131/261 - (50%) Gaps:32/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GFSNEEIRIVGGK-------PTGV----NQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKL 142
            |.|.:..:|:.|.       |.|.    :..||.|.::..|:..|||.|:...:||:||||    
  Rat    18 GISRDYPKILNGTNGTSGFLPGGYTCLPHSQPWQAALLVRGRLLCGGVLVHPKWVLTAAHC---- 78

  Fly   143 RKSKIRVIFGDHD-QEITSESQAIQRAVTAVIKHKSFDPD----TYNNDIALLRLRKPISFSKII 202
            ||....|..|.|. ..:.:..||::  |...|.|..:...    .:::||.||.|:.|:..|..:
  Rat    79 RKDGYTVHLGKHALGRVENGEQAME--VVRSIPHPEYQVSPTHLNHDHDIMLLELKSPVQLSNHV 141

  Fly   203 KPICLPRYNYDPAGRIGTVVGWG-RTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLC 266
            :.:.|...:..|.|....|.||| .||.....|..:....:.:.|..||| |.|.. :||::|||
  Rat   142 RTLQLSADDCLPTGTCCRVSGWGTTTSPQVNYPKTLQCANIELRSDEECR-QVYPG-KITANMLC 204

  Fly   267 AG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSNLEN 328
            ||  ....|||:|||||| |:.||..|   ||:||| ..||:...||||:||||::.||:..:.|
  Rat   205 AGTKEGGKDSCEGDSGGP-LICNGKLY---GIISWGDFPCGQPNRPGVYTRVSKYLRWIQGTIRN 265

  Fly   329 T 329
            |
  Rat   266 T 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/247 (36%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 85/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.