DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk6

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_062048.1 Gene:Klk6 / 29245 RGDID:3419 Length:251 Species:Rattus norvegicus


Alignment Length:246 Identity:90/246 - (36%)
Similarity:136/246 - (55%) Gaps:24/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDH 154
            :|.::.::|.|.|...|.:|:.|.:...|...|||.|:...:||:||||    :|..:.|..|.|
  Rat    22 WSEDQDKVVHGGPCLKNSHPFQAALYTSGHLLCGGVLVGPQWVLTAAHC----KKPNLEVYLGKH 82

  Fly   155 DQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPR----YNYDPA 215
            :...|...|. |.:|...|.|..::|.|::|||.::.|::|:.||:.|:|:.|.:    .|.|  
  Rat    83 NLRQTETFQR-QISVDRTIVHPRYNPQTHDNDIMMVHLKRPVKFSQRIQPLPLKKDCSEKNPD-- 144

  Fly   216 GRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMDSCQGD 278
               ..::|||: .|.||.|..:....|.::|..||  :|....:||.||:|||  |...||||||
  Rat   145 ---CQILGWGK-MENGEFPDTIQCADVQLVSREEC--ERAYPGKITRSMVCAGDKREGNDSCQGD 203

  Fly   279 SGGPLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSNLEN 328
            |||||:....::    |||||| :.||.:..||||:.|...|.||::.:.|
  Rat   204 SGGPLVCGGHLR----GIVSWGDMPCGSKEKPGVYTDVCTHIRWIQNIIRN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/234 (38%)
Klk6NP_062048.1 Tryp_SPc 28..244 CDD:214473 86/232 (37%)
Tryp_SPc 29..247 CDD:238113 88/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.