DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and TMPRSS11E

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:401 Identity:103/401 - (25%)
Similarity:166/401 - (41%) Gaps:96/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLKYIIFFWMLTANYSSVLSLEYSKGFNESDAINTIHTGHNKRTSKFLFDTIFRISSGVSNAFG 65
            :::.|:.:....|.||.|.||....|          ::....:..|....:...|:.|.|.|||.
Human    38 LTVHYVRYNQKKTYNYYSTLSFTTDK----------LYAEFGREASNNFTEMSQRLESMVKNAFY 92

  Fly    66 LS--------------------------------DTED--------------------------- 71
            .|                                .|||                           
Human    93 KSPLREEFVKSQVIKFSQQKHGVLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDP 157

  Fly    72 ------EVEYTENSS-LKNCDCDCGFS-----NEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGG 124
                  ::..||..| |.:|   ||..     .:.:|||||......::||.|.:.:||...||.
Human   158 HSVKIKKINKTETDSYLNHC---CGTRRSKTLGQSLRIVGGTEVEEGEWPWQASLQWDGSHRCGA 219

  Fly   125 SLLTKDYVLSAAHCVKKLRK-SKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIA 188
            :|:...:::|||||....:. ::....||     :|.:...::|.:..:|.|:.:...:::.||:
Human   220 TLINATWLVSAAHCFTTYKNPARWTASFG-----VTIKPSKMKRGLRRIIVHEKYKHPSHDYDIS 279

  Fly   189 LLRLRKPISFSKIIKPICLP--RYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECR 251
            |..|..|:.::..:..:|||  .|.:.| |.:..|.|:|.....|...:.:.|.:|.::..|.|.
Human   280 LAELSSPVPYTNAVHRVCLPDASYEFQP-GDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTCN 343

  Fly   252 NQRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLLLSNGVK-YFIVGIVSWGVGCGREGYPGVYS 313
            ..:..:..||..|||||  ....|:|||||||||:.|:... :::.||||||..|.:...||||:
Human   344 EPQAYNDAITPRMLCAGSLEGKTDACQGDSGGPLVSSDARDIWYLAGIVSWGDECAKPNKPGVYT 408

  Fly   314 RVSKFIPWIKS 324
            ||:....||.|
Human   409 RVTALRDWITS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 76/234 (32%)
TMPRSS11ENP_054777.2 SEA 51..156 CDD:307516 17/114 (15%)
Tryp_SPc 192..420 CDD:238113 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.