DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001008554.1 Gene:Tmprss11g / 289546 RGDID:1306446 Length:417 Species:Rattus norvegicus


Alignment Length:382 Identity:114/382 - (29%)
Similarity:177/382 - (46%) Gaps:80/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YIIFFWMLTANYSSVLSLEYSK-GFNESDAINTIHTGHNKRTSKFLFDTIFRISS---------- 58
            |...||:.:..|||.||.|.|| ..|....||      |:      .|.||:.||          
  Rat    50 YQASFWIPSIKYSSDLSEEQSKLQINLKQKIN------NE------IDVIFQRSSLKHHYVKSQV 102

  Fly    59 --------GV------------SNAFGLSDTED------------------------EVEYTENS 79
                    ||            .||..|....|                        |:...:..
  Rat   103 VNFRPSNDGVKADILIKFQIPRKNADTLRSEADSILNKKLQSSQSFLKRDISLPYLREMNAAQAE 167

  Fly    80 SLKNCDCDCGFSNEEI-RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLR 143
            .:.|.:|..|.....| ||..|||.|.|.:||.:.:..:|...||.||:...:::::|||....:
  Rat   168 HILNSNCGLGMEYPRIARIADGKPAGSNSWPWQSSLQVEGIHLCGASLIGSQWLVTSAHCFDNYK 232

  Fly   144 KSKI-RVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICL 207
            ..|: .|.||.     |..:....|.|.::|.|:::....:::|||:::|..|:.||:.::.:||
  Rat   233 NPKLWTVSFGR-----TLGNPLTTRKVESIIIHENYAAHKHDDDIAVVKLSSPVLFSENLRTVCL 292

  Fly   208 PRYNYD--PAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG-- 268
            |...:.  |..:: .|.|||.....|..|:.:.:|::.|:|...|.........|:|.|:|||  
  Rat   293 PEATFQVLPKSKV-FVTGWGALKANGPFPNSLQEVEIEIISNDVCNQVNVYGGAISSGMICAGFL 356

  Fly   269 RPSMDSCQGDSGGPLLLS-NGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKS 324
            ...:|:|:|||||||::| |..|::::||||||:.||:|..||:|:||:.:..||||
  Rat   357 TGKLDACEGDSGGPLVISDNRNKWYLLGIVSWGIDCGKENKPGIYTRVTHYRNWIKS 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 82/234 (35%)
Tmprss11gNP_001008554.1 SEA 48..142 CDD:279699 26/103 (25%)
Tryp_SPc 185..411 CDD:214473 79/231 (34%)
Tryp_SPc 186..414 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.