DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tmprss15

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:357 Identity:111/357 - (31%)
Similarity:173/357 - (48%) Gaps:57/357 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SKGFNESDAINTIH-TGHNKRTSKFLFDTIF----------RISSGVSNAFGLSDTEDE------ 72
            |.|.:|:..:..:: |..|....:|....|:          :||:.|.:..||......      
  Rat   673 SDGSDEAHCVRFLNGTQSNNGLVQFNIHNIWHIACAEPWTTQISNEVCHLLGLGSANSSMPILST 737

  Fly    73 -----VEYTE--NSSL-----KNCDCD-----------CG--FSNEEI--RIVGGKPTGVNQYPW 110
                 |...|  |.||     ..|..|           ||  ...:::  :||||..|....:||
  Rat   738 GGGPFVRLNEAPNGSLILTPSLQCSQDSLILLQCNHKSCGEKMVTQKVGPKIVGGSDTQAGAWPW 802

  Fly   111 MARIVY----DGKFHCGGSLLTKDYVLSAAHCV--KKLRKSKIRVIFGDHDQEITSESQAIQRAV 169
            :..:.|    ..:..||.||::.|:::||||||  :.|..::...:.|.|.|...:..|.::|.|
  Rat   803 VVALYYRDRSGDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVV 867

  Fly   170 TAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYN--YDPAGRIGTVVGWGRTS-EGG 231
            ..::.:..:|.....||||::.|...::::..|:|||||..|  :.| ||:.::.|||... ..|
  Rat   868 DRIVINPHYDKRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQTFTP-GRMCSIAGWGYNKINAG 931

  Fly   232 ELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLLLSNGVKYFIV 294
            ....::.:..||::|..:|: |:.....||.||||||  ....|||||||||||:.....::|:|
  Rat   932 STVDVLKEADVPLVSNEKCQ-QQLPEYDITESMLCAGYEEGGTDSCQGDSGGPLMCQENNRWFLV 995

  Fly   295 GIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            |:.|:||.|....:||||:|||:||.||.|.|
  Rat   996 GVTSFGVQCALPNHPGVYARVSQFIEWIHSFL 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/238 (37%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060 3/7 (43%)
Tryp_SPc 789..1025 CDD:238113 88/237 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGTX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.