DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss29

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:257 Identity:87/257 - (33%)
Similarity:127/257 - (49%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 IRIVGGKPTGVNQYPWMARI-VYDGKF----H-CGGSLLTKDYVLSAAHCVKK--LRKSKIRVIF 151
            :.||||......::||...: ||...:    | ||||::...:||:||||:.:  ...|..|:..
  Rat    29 VGIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYL 93

  Fly   152 GDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAG 216
            |   |......:.:.: |:.||.|..|......:|:|||:|.:.:.....:||:.|     .||.
  Rat    94 G---QVYLYGGEKLLK-VSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKL-----SPAS 149

  Fly   217 RIGT------VVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYKSTRITS--------SML 265
            ...|      |.|||..|....||.  .:.||:|.|:..|.|......:||:::        .||
  Rat   150 LEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDML 214

  Fly   266 CAGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLE 327
            |||....|||.|||||||:.:....:.:||:||||.||..:..||||:||..|:|||...::
  Rat   215 CAGSHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWITGQMQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 87/251 (35%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.