DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss30

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:247 Identity:91/247 - (36%)
Similarity:131/247 - (53%) Gaps:17/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFH-CGGSLLTKDYVLSAAHC-VKKLRKSKIRVIFGDHDQEI 158
            :||||:.....::||...:..:.:.| |||||:.:.:||:|||| .:.|..|...|..|.....:
  Rat    30 KIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTLSL 94

  Fly   159 TSESQAIQRAVTAVIKHKSF-DPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYD-PAGRIGTV 221
            | |..:...||..:..:.:: ..|..:.|||||||..|:..|: ..|:|||:.... ..|.:..|
  Rat    95 T-EPHSTLVAVRNIFVYPTYLWEDASSGDIALLRLDTPLQPSQ-FSPVCLPQAQAPLTPGTVCWV 157

  Fly   222 VGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTR-------ITSSMLCAG--RPSMDSCQG 277
            .|||.|.| .||.|::.::.||::...:|....:....       |.|.|||||  ....|||||
  Rat   158 TGWGATHE-RELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDSCQG 221

  Fly   278 DSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL-EN 328
            ||||||:.:....:..|||.|||:||.|...||||:||..::.||:..| ||
  Rat   222 DSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQRTLAEN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/240 (37%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.