DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG33226

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:258 Identity:79/258 - (30%)
Similarity:122/258 - (47%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHD---QE 157
            :|:||....:..:|||.:|:..|...|||||::..:||:||||..:.|   ::|.||.:.   ..
  Fly    46 QILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYR---LKVRFGRYSGITPR 107

  Fly   158 ITSESQ-----AIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPIC-LPRYNYDPAG 216
            ....||     ..:..|..:..|.|: .|.:|.||||..|.||:.::...:||| |...|.|...
  Fly   108 YLCSSQYCSPFGPEIDVKRIFLHSSY-RDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLR 171

  Fly   217 R------IGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYK------STRITSSMLCAGR 269
            :      :..|.|||:|.         :|:...|:..|...:...|      ..:|....:|||.
  Fly   172 QFLNYVAMFNVTGWGKTE---------SQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICAGH 227

  Fly   270 PSMDSCQGDSGGPL---LLSNGVKYFIV-GIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLEN 328
            ....:|.|||||||   |..:|||..:: ||:|:|....||  ..|::.|.::..||:..:.|
  Fly   228 SQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCRE--VTVFTNVLRYSNWIRDIVHN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 78/252 (31%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 78/252 (31%)
Tryp_SPc 47..282 CDD:214473 76/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.