DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tmprss5

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:336 Identity:105/336 - (31%)
Similarity:159/336 - (47%) Gaps:52/336 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DAINTIHTGHNKRTSKFLFDTI--FRISSGVSNAFGLSDTE--DEVEYTENSS------------ 80
            |.:...|.|.|......:..::  ||::.  ..|..|||.:  ...|:.:.|:            
  Rat   120 DWLLVCHEGWNPALGMHICQSLGYFRLTQ--HKAVNLSDIKLNRSQEFAQLSARPGSLVEEAWQP 182

  Fly    81 LKNC--------DC-DCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAA 136
            ..||        .| :||......|||||:.....::||.|.::...:..||.|:|...:|::||
  Rat   183 STNCPSGRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVMLGSRHTCGASVLAPYWVVTAA 247

  Fly   137 HCVKKLRKSKI---RVIFGDHDQEITSESQAIQR---AVTAVIKHKSFDPDTYNNDIALLRLRKP 195
            ||:...|.|::   ||..|     :.|.|...|.   .|..:|.|..:....::.|:|||:||.|
  Rat   248 HCMYSFRLSRLSSWRVHAG-----LVSHSAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTP 307

  Fly   196 ISFSKIIKPICLP-RYNYDPAGRIGTVVGWGRTSEGGELPS------IVNQVKVPIMSITECRNQ 253
            |:||..:..:||| :..:.|.|....|.|||.|.     ||      .:....||::|...|.:.
  Rat   308 INFSDTVSAVCLPAKEQHFPQGSQCWVSGWGHTD-----PSHTHSSDTLQDTMVPLLSTDLCNSS 367

  Fly   254 RYKSTRITSSMLCAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVS 316
            ...|..:|..|||||  ....|:|||||||||:..:|..:.:||:||||.||.....||||::|:
  Rat   368 CMYSGALTHRMLCAGYLDGRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKVA 432

  Fly   317 KFIPWIKSNLE 327
            :|:.||...::
  Rat   433 EFLDWIHDTVQ 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 87/242 (36%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 17/84 (20%)
Tryp_SPc 208..441 CDD:238113 87/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12330
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.