DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and KLK13

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:279 Identity:91/279 - (32%)
Similarity:134/279 - (48%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ISSGVSNAFGLSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKF 120
            :|.|||.              |:|.:.|.:...||      :.||.....:..||.|.::..|:.
Human    15 LSGGVSQ--------------ESSKVLNTNGTSGF------LPGGYTCFPHSQPWQAALLVQGRL 59

  Fly   121 HCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSF--DPD-- 181
            .|||.|:...:||:||||:|:    .::|..|.|........:.: |.|...|.|..:  .|.  
Human    60 LCGGVLVHPKWVLTAAHCLKE----GLKVYLGKHALGRVEAGEQV-REVVHSIPHPEYRRSPTHL 119

  Fly   182 TYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGWG-RTSEGGELPSIVNQVKVPIM 245
            .:::||.||.|:.|:..:..|:.:.|...|....|....|.||| .||.....|..:....:.:.
Human   120 NHDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLR 184

  Fly   246 SITECRNQRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWG-VGCGREG 307
            |..||| |.|.. :||.:|||||  ....|||:|||||||:.:.    .:.|||||| ..||:..
Human   185 SDEECR-QVYPG-KITDNMLCAGTKEGGKDSCEGDSGGPLVCNR----TLYGIVSWGDFPCGQPD 243

  Fly   308 YPGVYSRVSKFIPWIKSNL 326
            .||||:|||:::.||:..:
Human   244 RPGVYTRVSRYVLWIRETI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 82/235 (35%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 82/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.