DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and TPSG1

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:255 Identity:94/255 - (36%)
Similarity:130/255 - (50%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DCDCG---FSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVK-KLRKS 145
            |..||   .|:...|||||.......:||.|.:.......||||||:..:||:||||.. .|..|
Human    48 DLGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCFSGSLNSS 112

  Fly   146 KIRVIFGDHDQEITSESQAIQRAVTAVIKHK--SFDPDTYNNDIALLRLRKPISFSKIIKPICLP 208
            ..:|..|:.:..::.....:::    :|.|.  |..|.| :.||||:.|..|::.|..|.|:|||
Human   113 DYQVHLGELEITLSPHFSTVRQ----IILHSSPSGQPGT-SGDIALVELSVPVTLSSRILPVCLP 172

  Fly   209 RYNYD--PAGRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYK---STRITSSMLC 266
            ..:.|  |..|. .|.|||.|.||..||.  .:.:|||.::....||.. |.   .:.:...|||
Human   173 EASDDFCPGIRC-WVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRD-YPGPGGSILQPDMLC 235

  Fly   267 AGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            |..|. |:||.||||||:......:...|.||||.||||...||||:||..::.||:.::
Human   236 ARGPG-DACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 89/237 (38%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 88/235 (37%)
Tryp_SPc 63..293 CDD:238113 89/237 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.