DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG30289

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:260 Identity:83/260 - (31%)
Similarity:128/260 - (49%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DCGFSNEE---IRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIR 148
            :||.|.::   ..|.||..|.:.:.|||. :|:..| .|||||:.:.:||:|||||.   ...:.
  Fly    29 NCGISKDDPYVPNIFGGAKTNIQENPWMV-LVWSSK-PCGGSLIARQFVLTAAHCVS---FEDLY 88

  Fly   149 VIFGDHD----QEITSESQAIQR----AVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPI 205
            |..||::    ......:..|.:    :|...|.|::::..|..|||||||:.:.:.:|..::||
  Fly    89 VRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVEYSDYVRPI 153

  Fly   206 CL---------PRYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRIT 261
            ||         |.:         ||.|||.| |.|:...|:....:..|.|:.| |.:: :.:..
  Fly   154 CLLVGEQMQSIPMF---------TVTGWGET-EYGQFSRILLNATLYNMDISYC-NIKF-NKQAD 206

  Fly   262 SSMLCAGRPSMDSCQGDSGGPLL----LSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            .|.:|||..:.::|:|||||||.    ..|.:..|..|:||:|.........|||:.||....||
  Fly   207 RSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWI 271

  Fly   323  322
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 80/247 (32%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 78/245 (32%)
Tryp_SPc 42..271 CDD:238113 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.