DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG30288

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:294 Identity:88/294 - (29%)
Similarity:125/294 - (42%) Gaps:79/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TENSSLKNCDCDCGFSN-EEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCV 139
            ||:..|...||....|| ...||.||:..|:...|||.|::..||..|||||:|..:||:|.||:
  Fly    21 TESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCI 85

  Fly   140 KKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFD-------PDTYN------------- 184
            ..:   .:.|..|::|                 .:|..||       |..||             
  Fly    86 SPM---YMNVRLGEYD-----------------TRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPG 130

  Fly   185 NDIALLRLRKPISFSKIIKPICL---------P----RYNYDPAGRIGTVVGWGRTSEGGELPSI 236
            .||.|||:::.:.||..::||||         |    |:|:         .|||..|:|.|...:
  Fly   131 YDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNF---------TGWGTNSDGEEQDRL 186

  Fly   237 VNQV--KVPIMSITECRNQRYKSTRITSSMLCAGRPSMDSCQGDSGGPL----LLSNGVKYFIVG 295
            ....  ::|..|   |..   ....:..|.:|||....|||:|||||||    ......:.|..|
  Fly   187 QTATLQQLPQWS---CER---PGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFG 245

  Fly   296 IVSWGVG-CGREGYPGVYSRVSKFIPWIKSNLEN 328
            :.|.|:. |  .|. |:|:.|:.|..||...::|
  Fly   246 VASQGLRLC--SGL-GIYTNVTHFTDWILDVIQN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 79/267 (30%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 78/265 (29%)
Tryp_SPc 45..270 CDD:238113 76/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.