DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG30083

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:299 Identity:97/299 - (32%)
Similarity:152/299 - (50%) Gaps:57/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FLFDTIFRIS---SGVSNAFGLSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYP 109
            |:| |||:|.   .|..:.|                   .:.:||:.:...:|:.|:.......|
  Fly     2 FIF-TIFKIILLWPGAMSQF-------------------LEPNCGYPDISPKIMHGQNAENGTNP 46

  Fly   110 WMARIV-YDGK----FHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAV 169
            |||.|. |:.|    ..|||:|:.|.:|||||||:|  |...:.|..|:|       |.:...||
  Fly    47 WMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIK--RDQILAVRLGEH-------SSSRYFAV 102

  Fly   170 TAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTV-----VGWGRTSE 229
            |...::|.|...:|:|||.:||::..:.|:.:|:|||:..   ||. ::..|     .|||:| |
  Fly   103 TKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIIT---DPT-KVPNVKTFKAAGWGKT-E 162

  Fly   230 GGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSMDSCQGDSGGPLL----LSNGVK 290
            ......::..|::..::.:||.|..:  ..:|.|.:|||.|..|:|.|||||||:    :...::
  Fly   163 NETFSKVLKTVELNELNASECYNMLW--VNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLR 225

  Fly   291 YFIVGIVSWGVG-CGREGYPGVYSRVSKFIPWIKSNLEN 328
            |..:||:|:|.. |..   ||||:|:|.||.||...::|
  Fly   226 YVQLGIISFGSSLCNS---PGVYTRLSSFIDWILMVVDN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/242 (36%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 84/240 (35%)
Tryp_SPc 34..255 CDD:238113 84/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.