DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG30082

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:271 Identity:85/271 - (31%)
Similarity:130/271 - (47%) Gaps:53/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DCDCGF------SNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLR 143
            |.:||.      :|   |||||:...:...||:|.:..:....|.|:|:||.:||:||||:....
  Fly    25 DPNCGTTINLPPTN---RIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFH 86

  Fly   144 KSKIRVIFGDHDQEI-----------TSESQAIQRAVTAVIKHKSFD--PDTYNNDIALLRLRKP 195
            ...:|:  |::|...           |.|..:::.|..    |..|.  .|: .|||.||:|...
  Fly    87 LLTVRL--GEYDTSTRIDCTSEFCIPTYEEYSVENAYI----HTFFGGRQDS-RNDIGLLKLNGT 144

  Fly   196 ISFSKIIKPICLPRYNYDPAGRIG-----TVVGWGRTSEGGEL---PSIVNQVKVPIMSITECRN 252
            :.:...|:||||.|   || |::.     ...|||:.    :|   .:::..|.:..:..::|  
  Fly   145 VVYKLFIRPICLFR---DP-GQVPYSSTYEAAGWGKI----DLINTATVLQTVNLIRLDQSDC-- 199

  Fly   253 QRYKSTRITSSMLCAGRPSMDSCQGDSGGPL--LLSNG--VKYFIVGIVSWGVGCGREGYPGVYS 313
            :|...|.::....|||:...|:|.|||||||  .:|||  .:...:||||:|....|.  ||||:
  Fly   200 ERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG--PGVYT 262

  Fly   314 RVSKFIPWIKS 324
            .|..|..||.|
  Fly   263 YVPSFTNWILS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 80/253 (32%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 78/250 (31%)
Tryp_SPc 40..274 CDD:238113 80/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.