DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Ovch2

DIOPT Version :10

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_766496.2 Gene:Ovch2 / 244199 MGIID:3045251 Length:609 Species:Mus musculus


Alignment Length:66 Identity:15/66 - (22%)
Similarity:24/66 - (36%) Gaps:14/66 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SSSGGTPACGSNLVHSLSSA-TPSTGGSSISDSG-----------SDSKHPTDSISTP--SVDPH 96
            :|:....|.||.:.|::..| |...||...|::.           ..:.:|......|  ..||.
Mouse    62 ASTAAGVAVGSAVGHTIGHAMTGGFGGGGHSEAARPDVTYQEPYQGQAMYPPQQQQQPMYQQDPQ 126

  Fly    97 Q 97
            |
Mouse   127 Q 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 1/1 (100%)
Ovch2NP_766496.2 Tryp_SPc 52..297 CDD:238113 15/66 (23%)
CUB 317..420 CDD:238001
CUB 431..542 CDD:238001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..609
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.