DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:387 Identity:112/387 - (28%)
Similarity:169/387 - (43%) Gaps:81/387 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FFWMLTANYSSVLSLEYSKGFNESDAINTIHTGHNKRTSKFLFDTIFRISSGV-----SNAFGLS 67
            |:::  |:: .|.|::|.:.:....:...|...|.   .:.:...|||.||||     |:...:|
Mouse    60 FYYL--ASF-QVTSIKYRENYGIRSSREFIERSHQ---IERMMSRIFRRSSGVGRFIKSHVIKIS 118

  Fly    68 DTED-----------------------EVEYTENSSLK--------------------------- 82
            ..|.                       .:|.|...|||                           
Mouse   119 PDEQGVNILIVLMFRYPSTDSAERIKKRIERTFYQSLKIKQLPLTISMPSFSLTPIDSKKMRNLL 183

  Fly    83 NCDCDCGFSNEEI---------RIVGGKPTGV-NQYPWMARIVYDGKFH-CGGSLLTKDYVLSAA 136
            |..|....|:..|         |||.|:.|.: .::||.|.:...|..| ||.:|::..::|:||
Mouse   184 NSRCGIRMSSSNIPLPASSSTERIVQGRETAMEGEWPWQASLQLIGAGHQCGATLISNTWLLTAA 248

  Fly   137 HCVKKLR-KSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSK 200
            ||..|.| .:|..|.||     .|.....::|:|..:|.|:.:..||..|||||.:|...:.||.
Mouse   249 HCFWKNRDPTKWIVTFG-----TTITPPLVKRSVGKIIIHEEYHRDTNENDIALAQLTTRVEFSN 308

  Fly   201 IIKPICLPRYNYD-PAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSM 264
            :::.:|||..:.. |......|.|:|...:.|...:.:.|.:|..:....|..:......||..|
Mouse   309 VVQRVCLPDSSMKLPPKTSVFVTGFGSIVDDGPTQNKLRQARVETIGSDVCNRKDVYDGLITPGM 373

  Fly   265 LCAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKS 324
            ||||  ...:|:|:|||||||:..|...::||||||||..|.....||||:||:|:..||.|
Mouse   374 LCAGFMEGKIDACKGDSGGPLVYDNRDIWYIVGIVSWGQSCALPNKPGVYTRVTKYRDWIAS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 85/234 (36%)
Tmprss11fNP_848845.1 SEA 60..164 CDD:396113 22/109 (20%)
Tryp_SPc 207..436 CDD:238113 85/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.