DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and PRSS54

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:236 Identity:59/236 - (25%)
Similarity:108/236 - (45%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QYPWMARIVYDGKFHCG-GSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVT 170
            ::||:..:......|.. |.:|::.:|||.|..::  .:..|.||.|..:.: .|:....:..|.
Human    52 EFPWVVSLQDSQYTHLAFGCILSEFWVLSIASAIQ--NRKDIVVIVGISNMD-PSKIAHTEYPVN 113

  Fly   171 AVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPIC-LPRYNYDPAGRIGT-VVGWGRTSEGGE- 232
            .:|.|:.||.::.:|:||||:....:.|..:::.|| |.|..:.|...... |.||..||..|. 
Human   114 TIIIHEDFDNNSMSNNIALLKTDTAMHFGNLVQSICFLGRMLHTPPVLQNCWVSGWNPTSATGNH 178

  Fly   233 -LPSIVNQVKV------PIMSI--TECRNQRYKSTRITSSMLCAGRPSMDSCQGDSGGPLLLSNG 288
             ..|::.::.|      |:..:  |||.:...:.|:             .:|.||.|.|::..  
Human   179 MTMSVLRKIFVKDLDMCPLYKLQKTECGSHTKEETK-------------TACLGDPGSPMMCQ-- 228

  Fly   289 VKYFIVGIVSWGVGCGREGYPG--VYSRVSKFIPWIKSNLE 327
            ::.|.:.::...:..|.|..||  :|::|..:..||.|..|
Human   229 LQQFDLWVLRGVLNFGGETCPGLFLYTKVEDYSKWITSKAE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 57/232 (25%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 55/229 (24%)
Tryp_SPc 52..264 CDD:238113 55/229 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.