DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss27

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:256 Identity:84/256 - (32%)
Similarity:122/256 - (47%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKI-RVIF 151
            ||......|:|||:.....::||...|..:|...|||||:...:||:||||........| :|:.
Mouse    29 CGHPKMFNRMVGGENALEGEWPWQVSIQRNGIHFCGGSLIAPTWVLTAAHCFSNTSDISIYQVLL 93

  Fly   152 GDHDQEITSESQAIQRAVTAVIKHKSFDPD----TYNNDIALLRLRKPISFSKIIKPICLPRYNY 212
            |     .....|....|:...:|....:|.    ..:.|:||:.|:.|::|:..|.|:|||    
Mouse    94 G-----ALKLQQPGPHALYVPVKQVKSNPQYQGMASSADVALVELQGPVTFTNYILPVCLP---- 149

  Fly   213 DP-----AGRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECR-------NQRYKSTRITSS 263
            ||     :|....|.|||..||...||:  ::.::.|||:...:|.       ...::...|...
Mouse   150 DPSVIFESGMNCWVTGWGSPSEQDRLPNPRVLQKLAVPIIDTPKCNLLYNKDVESDFQLKTIKDD 214

  Fly   264 MLCAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            |||||  ....|:|:|||||||:......:...|::|||.||.|...||||.||:....||
Mouse   215 MLCAGFAEGKKDACKGDSGGPLVCLVDQSWVQAGVISWGEGCARRNRPGVYIRVTSHHKWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 81/247 (33%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 80/246 (33%)
Tryp_SPc 39..278 CDD:238113 81/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.