DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and St14

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:318 Identity:105/318 - (33%)
Similarity:168/318 - (52%) Gaps:37/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GFNES--DAINTIHTGHNKRTSKFLFDTIFRISSGVSNAFGLSDTEDEVEYTENSSLKNCDCDCG 89
            |.:|:  |::|.:      ..:|:    .:|..:|:..:.|..:.:.:.:.::.|..|||||...
Mouse   573 GSDEASCDSVNVV------SCTKY----TYRCQNGLCLSKGNPECDGKTDCSDGSDEKNCDCGLR 627

  Fly    90 FSNEEIRIVGGKPTGVNQYPWMARIVYDGKFH-CGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGD 153
            ...::.|:|||......::||...:...|:.| ||.||::.|:::|||||.:..:..|    :.|
Mouse   628 SFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDDKNFK----YSD 688

  Fly   154 H----------DQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLP 208
            :          ||...|.|...:..:..:|.|.||:..|::.|||||.|.|.:.:|.:::|||||
Mouse   689 YTMWTAFLGLLDQSKRSASGVQELKLKRIITHPSFNDFTFDYDIALLELEKSVEYSTVVRPICLP 753

  Fly   209 RYNY-DPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPS- 271
            ...: .|||:...|.|||.|.|||....|:.:.::.:::.|.|.:  ....:||..|:|.|..| 
Mouse   754 DATHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCED--LMPQQITPRMMCVGFLSG 816

  Fly   272 -MDSCQGDSGGPLLLSNGVK---YFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSN 325
             :||||||||||  ||:..|   .|..|:||||.||.:...||||:|:.....|||.:
Mouse   817 GVDSCQGDSGGP--LSSAEKDGRMFQAGVVSWGEGCAQRNKPGVYTRLPVVRDWIKEH 872

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 90/244 (37%)
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060 2/5 (40%)
LDLa 587..622 CDD:238060 6/38 (16%)
Tryp_SPc 635..872 CDD:238113 90/244 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.