DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk1b4

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:243 Identity:79/243 - (32%)
Similarity:122/243 - (50%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVT 170
            |..||...:....|:.|||.||.:::||:||||.    ..|.:|..|.:: .:..|.....|.|:
Mouse    29 NSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCY----NDKYQVWLGKNN-FLEDEPSDQHRLVS 88

  Fly   171 AVIKHKSFD-----------PDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVV-- 222
            ..|.|..|:           .|.|:||:.||||.||...:.::|||.||  ..:|  ::|:..  
Mouse    89 KAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITLP--TEEP--KLGSTCLA 149

  Fly   223 -GWGRTSE-GGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSMD----SCQGDSGG 281
             |||.|:. ..:.|..:..|.:.::...:|  .:....::|.:|||||  .||    :|:.||||
Mouse   150 SGWGSTTPIKFKYPDDLQCVNLKLLPNEDC--DKAHEMKVTDAMLCAG--EMDGGSYTCEHDSGG 210

  Fly   282 PLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSNLEN 328
            | |:.:|:   :.||.||| ..||....|.||:::.||..||:..:.|
Mouse   211 P-LICDGI---LQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMAN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 78/238 (33%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 78/238 (33%)
Activation peptide homolog 18..24
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.