DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:255 Identity:83/255 - (32%)
Similarity:128/255 - (50%) Gaps:35/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SNEEIRIVGGKPTGVNQYPWMARIVYDGKF---HCGGSLLTKDYVLSAAHCV------KKLRKSK 146
            :|:.:.||||.....:::||...:.:...:   .|||||:...:||:|||||      .:|.:.:
Mouse    26 ANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQ 90

  Fly   147 IR---VIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLP 208
            :|   :.:||         |.:  ::..::.|..:.......|:|||.|..|::.|..:.||.||
Mouse    91 LREQYLYYGD---------QLL--SLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISLP 144

  Fly   209 RYNYD-PAGRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYKSTRIT--------S 262
            ..:.. |.|....|.|||.......||.  .:.||||||:..:.| :::|.:...|        .
Mouse   145 PASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLC-DRKYHTGLYTGDDFPIVHD 208

  Fly   263 SMLCAGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            .|||||....|||||||||||:......:...|:||||.||.:...||:|:||:.::.||
Mouse   209 GMLCAGNTRRDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 82/249 (33%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 82/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.