DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk1b27

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_064664.1 Gene:Klk1b27 / 16619 MGIID:891980 Length:263 Species:Mus musculus


Alignment Length:256 Identity:79/256 - (30%)
Similarity:121/256 - (47%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKK--------LRKSKIRVIFG 152
            ||:||.....|..||...::...|:.|||.||..::||:||||...        |.|:|:     
Mouse    24 RIIGGFKCKKNSQPWHVAVLRSNKYICGGVLLDPNWVLTAAHCYGNDTSQHNVWLGKNKL----- 83

  Fly   153 DHDQEITSESQAIQRAVTAVIKHKSFD----------PDTYNNDIALLRLRKPISFSKIIKPICL 207
                 ...|..|..|.|:....|..::          |:..:||:.||||.||...:..:|||.|
Mouse    84 -----FQREPSAQHRWVSKSFPHPDYNMSLLNDHIPHPEDKSNDLMLLRLSKPADITDAVKPIDL 143

  Fly   208 PRYNYDPAGRIGTVV---GWGR-TSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG 268
            |  ..:|  ::|:..   |||. |....::|:.:..|.:.::....|......  ::|..|||.|
Mouse   144 P--TEEP--KLGSTCLASGWGSITPTKYQIPNDLQCVFIKLLPNENCAKAYVH--KVTDVMLCVG 202

  Fly   269 RP--SMDSCQGDSGGPLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSNL 326
            ..  ...:|:|||||| |:.:||.:   ||.||| :.|.:...|||::::.||..|||..:
Mouse   203 ETGGGKGTCKGDSGGP-LICDGVLH---GITSWGSIPCAKPNAPGVFTKLIKFTSWIKDTM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 78/252 (31%)
Klk1b27NP_064664.1 Tryp_SPc 24..255 CDD:214473 76/250 (30%)
Tryp_SPc 25..258 CDD:238113 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.