DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk1b24

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:248 Identity:80/248 - (32%)
Similarity:120/248 - (48%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITS 160
            |:|||.....|..||...:....|:.|||.||..::||:||||... ..|:..|..| .::....
Mouse    24 RVVGGFKCEKNSQPWHVAVFRYNKYICGGVLLNPNWVLTAAHCYGN-ATSQYNVWLG-KNKLFQR 86

  Fly   161 ESQAIQRAVTAVIKHKSFD----------PDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPA 215
            |..|..|.|:....|..::          |...:||:.||||.:|...:..:|||.||  ..:| 
Mouse    87 EPSAQHRWVSKSFPHPDYNMSLLNDDIPQPKDKSNDLMLLRLSEPADITDAVKPIDLP--TEEP- 148

  Fly   216 GRIGTVV---GWGR-TSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGR--PSMDS 274
             ::|:..   |||. |....:.|:.:..|.:.::....|......  ::|..|||||.  ...|:
Mouse   149 -KLGSTCLASGWGSITPTKWQKPNDLQCVFIKLLPNENCTKPYLH--KVTDVMLCAGEMGGGKDT 210

  Fly   275 CQGDSGGPLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSNL 326
            |.|||||| |:.:|:.:   ||.||| |.||:...|.:|:::.||..|||..:
Mouse   211 CAGDSGGP-LICDGILH---GITSWGPVPCGKPNAPAIYTKLIKFASWIKDTM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 79/244 (32%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 77/242 (32%)
Tryp_SPc 25..258 CDD:238113 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.