DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:269 Identity:85/269 - (31%)
Similarity:140/269 - (52%) Gaps:36/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKK--LRKSKIR 148
            ||||......|||||..:...::||.|.:...|:..|||:|:...:|::||||.::  :..:.:.
Human   557 CDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRWVITAAHCFQEDSMASTVLW 621

  Fly   149 VIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLP-RYNY 212
            .:|.....:.:.....:...|:.::.|...:.|:::.|:|||:|..|:..|..::|:||| |.::
Human   622 TVFLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHF 686

  Fly   213 DPAGRIGTVVGWGRTSEGG----------------------ELPSIVNQVKVPIMSITECRN-QR 254
            ...|....:.|||...||.                      .:.:.:.:|.|.::....|.. .|
Human   687 FEPGLHCWITGWGALREGALRADAVALFYGWRNQGSETCCCPISNALQKVDVQLIPQDLCSEVYR 751

  Fly   255 YKSTRITSSMLCAG--RPSMDSCQGDSGGPLL---LSNGVKYFIVGIVSWGVGCGREGYPGVYSR 314
            |   ::|..|||||  :...|:|||||||||:   ||.  ::|:.|:||||:||||..|.|||:|
Human   752 Y---QVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSG--RWFLAGLVSWGLGCGRPNYFGVYTR 811

  Fly   315 VSKFIPWIK 323
            ::..|.||:
Human   812 ITGVISWIQ 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 80/258 (31%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486 85/269 (32%)
Tryp_SPc 568..822 CDD:238113 80/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40976
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.