DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and F10

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus


Alignment Length:326 Identity:113/326 - (34%)
Similarity:174/326 - (53%) Gaps:38/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YSKGFNESDAINT-------IHTGHNKR-----TSKFLFDTIFRISSGVSNAFGLSDTEDEVE-- 74
            |..|.:....|:|       |.||..||     ||    |:...:...:.:...||.||:.:|  
Mouse   167 YFLGNDGKSCISTAPFPCGKITTGRRKRSVALNTS----DSELDLEDALLDEDFLSPTENPIELL 227

  Fly    75 -YTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIV-YDGKFHCGGSLLTKDYVLSAAH 137
             ..|....::       |::.:|||||:.....:.||.|.:: .|.:..|||::|.:.|:|:|||
Mouse   228 NLNETQPERS-------SDDLVRIVGGRECKDGECPWQALLINEDNEGFCGGTILNEFYILTAAH 285

  Fly   138 CVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKII 202
            |:.:.|:.|:||  ||.:.| ..|...:...|..||||..|..|||:.|||:|||:.||:|...:
Mouse   286 CLHQARRFKVRV--GDRNTE-KEEGNEMVHEVDVVIKHNKFQRDTYDYDIAVLRLKTPITFRMNV 347

  Fly   203 KPICLPRYNYDPA----GRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSS 263
            .|.|||:.::..:    .:.|.|.|:|||.|.|...:|:..::||.:....|:..  .|..||.:
Mouse   348 APACLPQKDWAESTLMTQKTGIVSGFGRTHEKGRQSNILKMLEVPYVDRNTCKLS--TSFSITQN 410

  Fly   264 MLCAGRPSM--DSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            |.|||..:.  |:||||||||.:......|::.||||||.||.|:|..|:|::|:.|:.||..::
Mouse   411 MFCAGYEAKLEDACQGDSGGPHVTRFKNTYYVTGIVSWGEGCARKGKYGIYTKVTTFLKWIDRSM 475

  Fly   327 E 327
            :
Mouse   476 K 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 93/234 (40%)
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011
FXa_inhibition 141..176 CDD:291342 2/8 (25%)
Tryp_SPc 243..471 CDD:214473 92/232 (40%)
Tryp_SPc 244..473 CDD:238113 93/233 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3752
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H30976
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11114
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4142
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.