DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk1b9

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:255 Identity:82/255 - (32%)
Similarity:128/255 - (50%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGD---HDQE 157
            |||||.....|..||...:....::.|||.||..::||:||||..:..|    |..|.   :::|
Mouse    24 RIVGGFKCEKNSQPWHVAVYRYNEYICGGVLLDANWVLTAAHCYYEENK----VSLGKNNLYEEE 84

  Fly   158 ITSESQAIQRAVTAV----------IKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNY 212
            .:::.:.:.::....          |:|..:|   |:||:.||||.||...:.::|||.||  ..
Mouse    85 PSAQHRLVSKSFLHPGYNRSLHRNHIRHPEYD---YSNDLMLLRLSKPADITDVVKPIALP--TE 144

  Fly   213 DPAGRIGTVV---GWGRTS-----EGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGR 269
            :|  ::|:..   |||.|:     ...:|..    |.:.::...:|.....:  ::|..|||||.
Mouse   145 EP--KLGSTCLASGWGSTTPFKFQNAKDLQC----VNLKLLPNEDCGKAHIE--KVTDVMLCAGE 201

  Fly   270 P--SMDSCQGDSGGPLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSNL 326
            .  ..|:|:|||||| |:.:||   :.||.||| ..||....||||:::.||..|||..:
Mouse   202 TDGGKDTCKGDSGGP-LICDGV---LQGITSWGFTPCGEPKKPGVYTKLIKFTSWIKDTM 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 81/251 (32%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 79/249 (32%)
Tryp_SPc 25..256 CDD:238113 81/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.