DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk1b22

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_034244.1 Gene:Klk1b22 / 13646 MGIID:95291 Length:259 Species:Mus musculus


Alignment Length:260 Identity:84/260 - (32%)
Similarity:125/260 - (48%) Gaps:57/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKK-----LRKSKIRVIFGDHD 155
            ||:||.....|..||...:.|..::.|||.||.:::||:||||.:.     |.|:|   :|.|  
Mouse    24 RILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNK---LFQD-- 83

  Fly   156 QEITSESQAIQRAVTAVIKHKSFDPD---------TYNNDIALLRLRKPISFSKIIKPICLPRYN 211
                 |..|..|.|:....|..|:..         ..:||:.||||.||...:.::|||.||  .
Mouse    84 -----EPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLP--T 141

  Fly   212 YDPAGRIGTVV---GWGRTSEGGELPSIVNQV------KVPIMSITECRNQ---RYKSTRITSSM 264
            .:|  ::|:..   |||.          :||:      .:..:||....|:   :....::|..|
Mouse   142 TEP--KLGSTCLASGWGS----------INQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVM 194

  Fly   265 LCAGRPS--MDSCQGDSGGPLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSNL 326
            ||||..:  .|:|:|||||| |:.:||   :.||.||| ..||....|.:|:::.||..|||..:
Mouse   195 LCAGEMNGGKDTCKGDSGGP-LICDGV---LQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTM 255

  Fly   327  326
            Mouse   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 83/256 (32%)
Klk1b22NP_034244.1 Tryp_SPc 24..251 CDD:214473 81/254 (32%)
Tryp_SPc 25..254 CDD:238113 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.