DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss29

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:256 Identity:88/256 - (34%)
Similarity:130/256 - (50%) Gaps:35/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IVGGKPTGVNQYPWMA--RIV-YDGKF---HCGGSLLTKDYVLSAAHCVKKLRKS----KIRV-- 149
            ||||......::||..  ||. |...|   :||||::...:||:||||:::....    :|||  
Mouse    31 IVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGE 95

  Fly   150 --IFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNY 212
              ::|  .:|:.|        |:.||.|..|......:|:|||:|...:.....:||:.||..:.
Mouse    96 AYLYG--GKELLS--------VSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESL 150

  Fly   213 DPAGR-IGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYKSTR--------ITSSMLC 266
            :...: :..|.|||..|....||.  .:.||:|.|:..:.|....:.:||        |...|||
Mouse   151 EVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLC 215

  Fly   267 AGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLE 327
            ||....|||.|||||||:.:....:.:||:||||.||....:||||:||..|:|||...::
Mouse   216 AGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/252 (35%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 88/252 (35%)
Tryp_SPc 31..271 CDD:214473 86/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.