DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:363 Identity:121/363 - (33%)
Similarity:177/363 - (48%) Gaps:60/363 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WMLTANYSSVLSLEYSKGFNESDAINTIHTGHNKRTSKFL--FDTIFRISSGVSN---------- 62
            |:..|.:..|   .| .|:.||::...:....:|:.|..|  :|.|....|..|.          
Zfish   185 WVFIATWDKV---PY-YGYRESESTFQVVLVSDKKRSFTLMHYDYITYTQSAESGYDTNGSTVFY 245

  Fly    63 AFGLSDTEDEVEYTENSSLK---------------NC------------DCDCGF--SNEEIRIV 98
            :..:||..: :.||.|.::|               :|            ...||.  .|.....|
Zfish   246 SIPVSDVTN-LPYTSNVNVKGRWVFRVDNSSEVKGSCINTNSQALDSPSAAVCGIIPVNSSNGTV 309

  Fly    99 GGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKS-KIRVIFGDHDQEITSES 162
            ||:.:....:||.|.:.:.....|||||:.|::|||||||....|.. .:.||.|...|.....|
Zfish   310 GGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLTVILGPKTQNKYDPS 374

  Fly   163 QAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPR----YNYDPAGRIGTVVG 223
            : |.|:|.|||||..::|:|.:|||||:||..||:|:..|:|:||..    :|.|....|.|   
Zfish   375 R-ISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNSDTESWITT--- 435

  Fly   224 WGRTSEGGELPS--IVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLL 284
            |...|:|..|||  |..:|:||::...:| |..|....||.:|:|||  :...|.||||||||::
Zfish   436 WRNISDGVPLPSPKIFQEVEVPVIGNRQC-NCLYGVGSITDNMICAGLLKEGKDLCQGDSGGPMV 499

  Fly   285 LSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            .:....:...||||:|.||.:..:||||:|||::..||
Zfish   500 SNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 97/235 (41%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 20/91 (22%)
Tryp_SPc 309..537 CDD:238113 95/232 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.