DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and MASP2

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:268 Identity:96/268 - (35%)
Similarity:136/268 - (50%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SLKNCDCDCGFSNEEI--RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCV--K 140
            ||..|:..||.|....  ||.||:......:||...|:  |.....|:||..::||:|||.|  :
Human   426 SLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLIL--GGTTAAGALLYDNWVLTAAHAVYEQ 488

  Fly   141 KLRKSKIRVIFG------DHDQEITSESQAIQRAVTAVIKHKSFDPDT-YNNDIALLRLRKPISF 198
            |...|.:.:..|      .|..:..||         ||..|:.:..|. ::|||||::|...:..
Human   489 KHDASALDIRMGTLKRLSPHYTQAWSE---------AVFIHEGYTHDAGFDNDIALIKLNNKVVI 544

  Fly   199 SKIIKPICLPRYNYDPAGR---IGTVVGWGRTSEGGELPSIVNQVKVPIMSITEC----RNQRYK 256
            :..|.||||||...:...|   |||..|||.| :.|.|...:..|.:||:...:|    ....|.
Human   545 NSNITPICLPRKEAESFMRTDDIGTASGWGLT-QRGFLARNLMYVDIPIVDHQKCTAAYEKPPYP 608

  Fly   257 STRITSSMLCAGRPS--MDSCQGDSGGPLLL--SNGVKYFIVGIVSWG-VGCGREGYPGVYSRVS 316
            ...:|::|||||..|  .|||:|||||.|:.  |...::|:.|||||| :.||..|..|||::|.
Human   609 RGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVI 673

  Fly   317 KFIPWIKS 324
            .:||||::
Human   674 NYIPWIEN 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 89/249 (36%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478
Sushi 366..430 CDD:278512 2/3 (67%)
Tryp_SPc 444..679 CDD:214473 88/246 (36%)
Tryp_SPc 445..682 CDD:238113 89/249 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.