DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and LOC103908930

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:236 Identity:81/236 - (34%)
Similarity:124/236 - (52%) Gaps:16/236 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITS 160
            :|:||.....|..||...|..||:..||.||:.:.:.:|||||  .:..:.:.|..|.|:.::..
Zfish    20 KIIGGYECPPNSQPWQIYITNDGQRWCGASLINESWAVSAAHC--NIGANLLTVYLGKHNIDVVE 82

  Fly   161 ESQAIQRAVT-AVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGW 224
            :::  ||..| .|..|..|...:.:|||.|::|:.|..|::.::||.|.. :....|....|.||
Zfish    83 KTE--QRIRTEKVFPHPEFKFPSEDNDIMLIKLKDPAVFNQYVQPIPLAT-SCSSEGEQCLVSGW 144

  Fly   225 GRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLLLSN 287
            |.|..|  |||::..:.:.:.|..||  :|....:.|.:|||||  ......|.|||||||:.:.
Zfish   145 GYTEVG--LPSVLQCLDLAVQSRQEC--ERVYKDKFTQNMLCAGFMEGGKGVCHGDSGGPLVCNG 205

  Fly   288 GVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLEN 328
            .::    |:||||.||...|||.||..|.::..||.:.:.|
Zfish   206 ELR----GVVSWGAGCAEPGYPAVYVEVCRYSDWIATTIAN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 80/230 (35%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.