DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk5

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:286 Identity:87/286 - (30%)
Similarity:140/286 - (48%) Gaps:37/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GLSD--TEDEVEYTENSSLK---------NCDCDCG---FSNEEIRIVGGKPTGVNQYPWM-ARI 114
            |:|:  ..|:|...:|||..         |.|.:.|   .|:...|||.|.....:..||. |.:
  Rat    22 GVSELALADDVASCDNSSGTKPSGTNRDLNTDSNSGEDTRSDSSSRIVNGSDCPKDTQPWQGALL 86

  Fly   115 VYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSES-QAIQRAVTAVIKHKSF 178
            :...|.:||..|:...::|:||||    ||...|:..|.|......|| |.:.:.:.: |.|..:
  Rat    87 LGPNKLYCGAVLINPQWLLTAAHC----RKPVFRIRLGHHSMSPVYESGQQMFQGIKS-IPHPGY 146

  Fly   179 DPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGT---VVGWGRTSEG-GELPSIVNQ 239
            ....::||:.|:::.:.|..|..:||:.:.    ....:.||   |.|||.||.. ...|.::..
  Rat   147 SHPGHSNDLMLIKMNRKIRASHSVKPVEIT----SDCPKEGTRCMVSGWGTTSSSHNNFPKVLQC 207

  Fly   240 VKVPIMSITECRNQRYKSTRITSSMLCAG-RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWG-VG 302
            :.:.::|...|:|. |.. :|..:|.||| ....||||||||||::.:..::    |:|||| ..
  Rat   208 LDITVLSEERCKNS-YPG-QIDKTMFCAGDEAGRDSCQGDSGGPVICNGKLQ----GLVSWGDFP 266

  Fly   303 CGREGYPGVYSRVSKFIPWIKSNLEN 328
            |.:...||||:.:.:|:||||..:.:
  Rat   267 CAQPNRPGVYTNLCEFVPWIKDTIHS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 75/235 (32%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.