DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and LOC101733979

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_031749509.1 Gene:LOC101733979 / 101733979 -ID:- Length:895 Species:Xenopus tropicalis


Alignment Length:268 Identity:82/268 - (30%)
Similarity:123/268 - (45%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFG 152
            ||....:.||.||..|...::||.|.:.|.||.:|||||::.||:|:||||.             
 Frog    30 CGRQGPQSRIYGGSDTYPGEWPWYAMLHYLGKPYCGGSLISNDYILTAAHCF------------- 81

  Fly   153 DHDQEI-TSESQAIQ----------RAVTAVIK------HKSFDPDTYNNDIALLRLRKPISFSK 200
            |.|..: |.||..||          ...|.::|      |:.:......:|:||::|.||::|:.
 Frog    82 DGDLSLRTPESWTIQLGSSRVGGPPERSTLILKASQILLHEDYIHFLDGHDLALIKLAKPVTFTS 146

  Fly   201 IIKPICLPRYNYD-PAGRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYKS----- 257
            .:.|:|||...:. ...|....:|....:.|..|.|  .:.:|...::....| |..|.|     
 Frog   147 FVSPVCLPEVQHRFRLRRTCWALGLQDVAPGVPLDSKRSLQKVTQTLIGYKTC-NCIYNSHGRPE 210

  Fly   258 -TRIT-SSMLCAGRPSMDS--CQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKF 318
             |..| .|||||.....:.  |.||||||::......:|:.|::|:..||.....|.|.:.||.:
 Frog   211 LTNATLPSMLCAAESDGEKGPCLGDSGGPVVCQEDGAWFLAGVISFSQGCHLRDSPTVLTAVSLY 275

  Fly   319 IPWIKSNL 326
            ..|||..:
 Frog   276 QDWIKQKV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 79/256 (31%)
LOC101733979XP_031749509.1 Tryp_SPc 39..282 CDD:238113 79/256 (31%)
Tryp_SPc 323..555 CDD:238113
Tryp_SPc 598..824 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.