DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and LOC100535114

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_009296342.3 Gene:LOC100535114 / 100535114 -ID:- Length:329 Species:Danio rerio


Alignment Length:273 Identity:94/273 - (34%)
Similarity:135/273 - (49%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEI--RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVI 150
            ||..|...  |||||.......:|||..:...|...|||||:...:||:||||:.....|.:.|.
Zfish    25 CGRPNPNFNPRIVGGVNATEGSWPWMVSLRKSGVHFCGGSLINNQWVLTAAHCISGKTTSSMHVY 89

  Fly   151 FGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYD-P 214
            .|...:..|.::: |.|.|..:|.|.|::..|.:||||||:|...:.::..||||||...|.: |
Zfish    90 LGKWRRYETDQNE-ITRTVIDIIPHPSYNNRTSDNDIALLQLSATVQYTVYIKPICLADQNSNFP 153

  Fly   215 AGRIGTVVGWGRTSEGG--------------ELPSIVNQVKVPIMSITECRNQRYKSTRITSSML 265
            .|....|.||||....|              ..|.|:.:|::.:.|..:| ::|.:.. ||.:|:
Zfish   154 RGTRSWVTGWGRIGVSGTGGISGRTTVSVPLPAPGILQEVELQVYSNEKC-SKRCQGP-ITPNMI 216

  Fly   266 CAGRPS--MDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL-- 326
            |||..|  ..:..|||||||:......:...|:||.|.||.:...|||:.|||::..||..|:  
Zfish   217 CAGTRSGGKGTFYGDSGGPLMSKQCSVWVQAGVVSHGYGCAQPKIPGVFIRVSEYKQWITDNIGG 281

  Fly   327 --------ENTCL 331
                    :.|||
Zfish   282 NLPGFVLFDPTCL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/244 (35%)
LOC100535114XP_009296342.3 Tryp_SPc 36..278 CDD:238113 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.