DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and tmprss6

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:277 Identity:89/277 - (32%)
Similarity:139/277 - (50%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ENSSLKNC-------DCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLS 134
            |..|:.:|       :|.||.....||:|||......::||.|.:...|:..|||:|:...::|:
 Frog   544 ECDSIADCPDGSDENNCGCGIQAVGIRLVGGTQAQEGEWPWQASLQVRGEHICGGTLVADQWILT 608

  Fly   135 AAHC---------------VKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYN 184
            ||||               :.|:|.|:             |..:.:...|..::.|..:|.|:::
 Frog   609 AAHCFTPESYASPEVWTVYLGKVRLSR-------------STQKELAFKVIRLVIHPFYDEDSHD 660

  Fly   185 NDIALLRLRK--PISFSKIIKPICLPRYNYD-PAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMS 246
            .|:||:.|..  |:: |..::|||||...:. |.|....|.|||...|.|....::.:|.:.:::
 Frog   661 YDVALVLLDHLVPLT-SPHVQPICLPSSTHHFPTGSSCWVTGWGSVKENGPTSDVLQKVDIQLVA 724

  Fly   247 ITECRN-QRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLLLSNGV-KYFIVGIVSWGVGCGREG 307
            ...|.. .||   :|:..|||||  ..|.|:||||||.||:..... ::|..|:||||.|||...
 Frog   725 QDICTELYRY---QISPRMLCAGYRDGSKDACQGDSGSPLVCKTASGRWFQAGLVSWGAGCGIPR 786

  Fly   308 YPGVYSRVSKFIPWIKS 324
            |.|||||:::.:.||:|
 Frog   787 YFGVYSRITRLVQWIES 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 81/250 (32%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060 3/15 (20%)
Tryp_SPc 572..804 CDD:238113 81/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.