DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and tmprss11f

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:341 Identity:107/341 - (31%)
Similarity:163/341 - (47%) Gaps:43/341 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NYSSVLSLEYSKG---------FN------ESDAINTIHTGHNKRTSKFLFDT------IFRISS 58
            |.|.|:||  |.|         ||      .:..:..|...:.|.|||..||.      :..|||
 Frog    97 NSSQVISL--SPGSVIPVFVLLFNFVNNGSSASTVQGIFVENMKNTSKTGFDVDQSSLHLSEISS 159

  Fly    59 GVSNAFGLSDTEDEVEYTENSSLKNCDCD---CGFSNEEI--RIVGGKPTGVNQYPWMARIVYDG 118
            ..:.....|.......||..::      |   ||.....:  |||||...|:..:||.|.:...|
 Frog   160 SDAQNLLYSVPSTTTAYTTTAA------DFTACGIGGPSVSNRIVGGTNAGLGSWPWQASLRLLG 218

  Fly   119 KFHCGGSLLTKDYVLSAAHCV-KKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDT 182
            ...||.|||...::::||||. .....:...|:.|..:....||.:     :..:|.::.:....
 Frog   219 SHTCGASLLNDTWLVAAAHCFDMNADANSWTVVLGTINVYSGSEFK-----IEKIIIYEGYTSHN 278

  Fly   183 YNNDIALLRLRKPISFSKIIKPICLPR-YNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMS 246
            :.||||||:|..|::|:.||:|:|||. .:..|.|....:.|||..::||....::.|.:|.|::
 Frog   279 HRNDIALLKLFTPLNFTSIIRPVCLPEASDIFPDGSSCYITGWGALTDGGSASQVLQQAEVKIIN 343

  Fly   247 ITECRNQRYKSTRITSSMLCAGRPS--MDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYP 309
            ...|.:.:.....|..||:|||..:  :|||||||||||:.....::.::||||:|.||.....|
 Frog   344 SDTCSSSQMYGGLIYPSMICAGYATGQIDSCQGDSGGPLVTLKSGRWVLIGIVSFGYGCALPNKP 408

  Fly   310 GVYSRVSKFIPWIKSN 325
            |||||::....||.::
 Frog   409 GVYSRITYLRNWITAH 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 81/231 (35%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113 16/52 (31%)
Tryp_SPc 197..421 CDD:238113 79/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.