DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and zgc:165423

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:256 Identity:94/256 - (36%)
Similarity:138/256 - (53%) Gaps:23/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CDCD-------CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCV-K 140
            |||.       ||.:....:||||.......:||.|.:...|...|||||::..::||||||. .
Zfish    18 CDCQPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPS 82

  Fly   141 KLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPI 205
            ....|...|..|...|::.:.:: :.::|:.||.|..:...|::||:|||.|..|::||..|:|:
Zfish    83 NPNPSDYTVYLGRQSQDLPNPNE-VSKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPV 146

  Fly   206 CLPR-----YNYDPAGRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYKSTRITSS 263
            ||..     || |..    .:.|||....|..|||  |:.:|.|||:....|.......:.||::
Zfish   147 CLAADGSTFYN-DTM----WITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNN 206

  Fly   264 MLCAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            |:|||  :...||||||||||:::.:...:...|:||:|.||....|||||:|||::..||
Zfish   207 MMCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 89/236 (38%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 87/235 (37%)
Tryp_SPc 38..269 CDD:238113 89/236 (38%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.