DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and LOC100004427

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:297 Identity:86/297 - (28%)
Similarity:140/297 - (47%) Gaps:62/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LFDTIFRISSGV----SNAFGLSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYP 109
            :|:|:|.::..|    :...|.||.                  ||.:....:||||.......:|
Zfish     2 MFNTVFCVAGAVLLNIAGCLGQSDV------------------CGRAPLNTKIVGGLNATEGSWP 48

  Fly   110 WMARIVY--DGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEIT---SESQAIQRAV 169
            |.|.|.:  .|:|.|.|||:::.:||:||.|.:::..|.:.:..|    .:|   |....|.|.|
Zfish    49 WQASINFKSTGQFFCSGSLISERWVLTAASCFQRINVSDVVIYLG----RLTTNGSNPYEIPRTV 109

  Fly   170 TAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRI---GT---VVGWGRTS 228
            ..|         :...||||::|...::|:..|:|:||.     .||.:   ||   |.|||.||
Zfish   110 IQV---------SVTEDIALVQLSSSVTFTDYIRPVCLA-----AAGSVFVDGTESWVTGWGSTS 160

  Fly   229 EGGE-LPSIVNQVKVPIMSITECRNQRYKSTRITS--SMLCAG---RPSMDSCQGDSGGPLLLSN 287
            .... |..::.:|:.||::..||.|    ...||:  :::|||   ......|..|.|.||:...
Zfish   161 STNVILSDMLKEVEAPIVNNIECSN----INGITNLDNVICAGFVNETGKAPCWEDFGSPLVTRQ 221

  Fly   288 GVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKS 324
            |.::...|:|.: ..||:.|:|.:|:|||::..||::
Zfish   222 GSQWIQSGVVVF-TFCGQNGFPTLYARVSEYEEWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 77/245 (31%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 75/242 (31%)
Tryp_SPc 36..257 CDD:238113 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.