DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11839 and AT3G02860

DIOPT Version :9

Sequence 1:NP_733077.3 Gene:CG11839 / 43006 FlyBaseID:FBgn0039271 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_850505.1 Gene:AT3G02860 / 821212 AraportID:AT3G02860 Length:313 Species:Arabidopsis thaliana


Alignment Length:318 Identity:74/318 - (23%)
Similarity:120/318 - (37%) Gaps:91/318 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKKLSVSKKPAVTVDSPLAKYDSSGILTCIICRIPIK-PNVWKVHINSKQHKLNVDQAKQN---- 69
            :.||:..||. ..:||||.:|:.|....|.:|.:.:| .::|.||..|::|...:|..|.:    
plant    12 RSKLNAKKKD-TRIDSPLVRYNESDQPVCRVCNVVLKSESLWDVHQASRKHHEAIDSLKASAAGV 75

  Fly    70 -KVEKPVTTTAPKDPTGPSTKTSAPAK--NSSTLPDKTPQSSQEKHPP-----------LIQEKT 120
             :..||..|.        .||..|.||  ||.|.....|...:.:.|.           |.|.|.
plant    76 QRGSKPAETR--------PTKIEALAKSSNSQTSSGLPPNFFENREPARAEVEPAKSKNLEQSKH 132

  Fly   121 AQGNASSKPENETTVEKLPEKFFDEDKTNKSEAARLQDEEWQRFQ-------------------- 165
            ..|:.::|.:.     .||..|||..||:.|......:.:..:.|                    
plant   133 TIGSETNKSKG-----PLPAGFFDNQKTDSSNTKTTSEPKQSQTQTTGPETKPMVNGNLPTGFFD 192

  Fly   166 ---------------QEIKRADTESSEIVAD---------EQEDINLKRHIKEIDEQID--NWKR 204
                           .:||....|..:::.|         |:|:::....|:| :||.:  ::|.
plant   193 NKEADLLAHGIKLVKPDIKDEYKEFEKLIQDDLQVVDSRMEEEEVDAAETIEE-EEQREQRSYKE 256

  Fly   205 FIKINDQKKVLLSKKR----------RVDPKMEVDPELSSSEEDCSVDDLFDWRTKNL 252
            .::|..:||:.|...|          .|....:.:.|..|.||| ..|...|||.::|
plant   257 KVEILKRKKMELKAARLAKRSKTSEGSVKKPKKTEEESPSDEED-DEDSAVDWRAQHL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11839NP_733077.3 None
AT3G02860NP_850505.1 zf-met 39..61 CDD:372354 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3032
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2581
OMA 1 1.010 - - QHG60282
OrthoDB 1 1.010 - - D1458826at2759
OrthoFinder 1 1.000 - - FOG0006403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106584
Panther 1 1.100 - - LDO PTHR13278
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.