DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11839 and zgc:77398

DIOPT Version :9

Sequence 1:NP_733077.3 Gene:CG11839 / 43006 FlyBaseID:FBgn0039271 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_991227.1 Gene:zgc:77398 / 402963 ZFINID:ZDB-GENE-040426-1834 Length:326 Species:Danio rerio


Alignment Length:312 Identity:77/312 - (24%)
Similarity:128/312 - (41%) Gaps:72/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NIKRLQKKLSVSKKPAVTVDSPLAKYDSSGILTCIICRIPIK-PNVWKVHINSKQHKLNVDQAKQ 68
            :::||.::..........|:||.|:|..:|.|.|.:|..|:| ..:|:.|:..||||..:.:.|.
Zfish    17 DLRRLMQETRRDSGRQKRVESPFARYSGAGQLMCALCDAPVKNALLWQTHVLGKQHKDKLQELKS 81

  Fly    69 NKVEKPVTTTAP-----KDPTGPSTKTS----------APAKNS--------------------- 97
            ...  |..|.||     ..|...|:.:|          ||.|.:                     
Zfish    82 RTA--PAHTPAPAHTPAHTPAAASSSSSTLKRAAEPPPAPGKRAKLQTGAGAGLGLLAGHYDDDD 144

  Fly    98 ----------------STLPDKTPQSSQEKHPPLIQ----EKTAQGNASSKPENETTVEKLPEKF 142
                            |.||.....|.....||:..    .|..|..:...|||..  |.|||.|
Zfish   145 DDEGGAGERKTAPPTDSALPADFFDSGPAPAPPISHSGSVSKAEQQESQEPPENRP--ESLPEGF 207

  Fly   143 FDEDKTNKSEAARLQ------DEEWQRFQQEIKRADTESSEIVADEQEDINLKRHIKEIDEQIDN 201
            || |....::..::.      :.||:.||:|:::.::.|..|||::.|:..|:|.:.||:||:..
Zfish   208 FD-DPVRDAQVRQVDTPKDQLEREWEEFQKEMRQVNSASDAIVAEDDEEGRLERQMDEIEEQMQC 271

  Fly   202 WKRFIKINDQKKVLLSKK---RRVDPKMEVDPELSSSEEDCSVDDLFDWRTK 250
            .:|..::..:::...|::   ||.:..|:.:..|...||...:... |||.|
Zfish   272 LRRVEELRAKQETARSRRRSQRREEEPMQEEEPLEEEEELMHILTQ-DWRAK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11839NP_733077.3 None
zgc:77398NP_991227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37 3/19 (16%)
zf-C2H2_jaz 47..73 CDD:288983 9/25 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..214 29/135 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..257 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..309 5/32 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9993
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41655
Inparanoid 1 1.050 84 1.000 Inparanoid score I5160
OMA 1 1.010 - - QHG60282
OrthoDB 1 1.010 - - D1458826at2759
OrthoFinder 1 1.000 - - FOG0006403
OrthoInspector 1 1.000 - - oto39212
orthoMCL 1 0.900 - - OOG6_106584
Panther 1 1.100 - - LDO PTHR13278
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5351
SonicParanoid 1 1.000 - - X6139
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.