DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11839 and sel-13

DIOPT Version :9

Sequence 1:NP_733077.3 Gene:CG11839 / 43006 FlyBaseID:FBgn0039271 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_497963.1 Gene:sel-13 / 175617 WormBaseID:WBGene00011411 Length:234 Species:Caenorhabditis elegans


Alignment Length:254 Identity:71/254 - (27%)
Similarity:123/254 - (48%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VTVDSPLAKYDSSGILTCIICRIPIKPNVWKVHINSKQHKLNVDQAKQN--KVEKPVTTTAPKDP 83
            ::::..:||...:|.:.|::|...|||.:|..|:|.|:|:.::::.|.:  |..|..:|....:|
 Worm     1 MSLNPMIAKQKPNGNIQCLVCNAEIKPKIWTAHVNGKKHRDSIEKLKTSAQKRGKESSTRNTDEP 65

  Fly    84 TGPSTKTSAPAKNSSTLP------DKTPQSSQEKHPPLIQEKTAQGNASSKPENETTVEKLPEKF 142
            .....| ..|.:..:|||      :.||....:       .|||     :...|...:|.:|..|
 Worm    66 PNKKQK-EVPNQGPTTLPTDFFDDESTPFRKDD-------SKTA-----TVGHNSNLIEGVPAGF 117

  Fly   143 FDEDKTN------KSEAARLQDEEWQRFQQEI----KRADTESSEIVADEQEDINLKRHIKEIDE 197
            ||:.:.:      :...|.| |.|::|:::||    ...||::.|:.|..|.::.|:|    |||
 Worm   118 FDDKRLDGNVRETRERNAEL-DAEYERWKEEIGEEQVELDTKAEELEAAVQRELELER----IDE 177

  Fly   198 QIDNWKRFIKIND---QKKVLLSKKRRVDPKMEVDPELSSSEEDCSVD-DLFDWRTKNL 252
            |:...|   |:||   ||:..|::.|....|.| :||....::...:| |..|||.||:
 Worm   178 QMAALK---KLNDMEIQKEKRLNQARERRLKRE-EPEEEEDDDGEDIDLDALDWRAKNI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11839NP_733077.3 None
sel-13NP_497963.1 Ax_dynein_light <129..198 CDD:287215 25/76 (33%)
OmpH <129..>195 CDD:281871 24/73 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166383
Domainoid 1 1.000 85 1.000 Domainoid score I5214
eggNOG 1 0.900 - - E1_KOG3032
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I3733
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60282
OrthoDB 1 1.010 - - D1458826at2759
OrthoFinder 1 1.000 - - FOG0006403
OrthoInspector 1 1.000 - - oto18078
orthoMCL 1 0.900 - - OOG6_106584
Panther 1 1.100 - - LDO PTHR13278
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5351
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.