DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3B and RpL35

DIOPT Version :10

Sequence 1:NP_524494.1 Gene:Stt3B / 43005 FlyBaseID:FBgn0011336 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_572243.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster


Alignment Length:59 Identity:14/59 - (23%)
Similarity:27/59 - (45%) Gaps:7/59 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   718 LVRIYRVK--KPHEFNRPSLKTKERTIPPANFISRKNSKRRKGYIRNRPVVVKGKRTLK 774
            |.::::.|  ||.:..:...:...:.:.|.: .:||..|.    ||.|.|..:.|..:|
  Fly    69 LRKVFKNKKYKPLDLRKKKTRAIRKALSPRD-ANRKTLKE----IRKRSVFPQRKFAVK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stt3BNP_524494.1 STT3 18..514 CDD:396873
RpL35NP_572243.1 Ribosomal_L29 7..63 CDD:459954
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.