DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PQBP1 and AT2G41020

DIOPT Version :9

Sequence 1:NP_651331.1 Gene:PQBP1 / 43004 FlyBaseID:FBgn0039270 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_181635.2 Gene:AT2G41020 / 818702 AraportID:AT2G41020 Length:463 Species:Arabidopsis thaliana


Alignment Length:198 Identity:39/198 - (19%)
Similarity:67/198 - (33%) Gaps:63/198 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYKEDTSPEPKRRSVEEKF 66
            :||..|.|:||.||::  :.||..::...|:..|.::   ::....|::.:.|..|         
plant   145 NLPEYLKQKLKARGIL--RDGAGAVTSNPEDTSAVSW---NRQATLPFQANASTLP--------- 195

  Fly    67 WSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLYCVNKFNSSPLSQPSHRYLKRYKRLLRKYPLE 131
                    :|..::                          ..|.|..::.|.:.......:.|:|
plant   196 --------LGWVDA--------------------------KDPASGATYYYNQHTGTCQWERPVE 226

  Fly   132 AG--------------WKDVYDKGCKAFYFYNSTTQTVSWLPP-SHPKARITNSAAVFRRQLANS 181
            ..              |.:.:|:.....||||:.|....|.|| |..|...|||.....:..||.
plant   227 LSYATSSAPPVLSKEEWIETFDEASGHKYFYNTRTHVSQWEPPASLQKPAATNSNNAVTQSTANG 291

  Fly   182 NDE 184
            ..|
plant   292 KGE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PQBP1NP_651331.1 WW 130..160 CDD:278809 9/43 (21%)
AT2G41020NP_181635.2 WW 194..224 CDD:278809 5/72 (7%)
WW 241..269 CDD:278809 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3427
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106865
Panther 1 1.100 - - LDO PTHR21737
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.860

Return to query results.
Submit another query.