DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PQBP1 and pqbp1

DIOPT Version :9

Sequence 1:NP_651331.1 Gene:PQBP1 / 43004 FlyBaseID:FBgn0039270 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001002435.1 Gene:pqbp1 / 796523 ZFINID:ZDB-GENE-030616-158 Length:261 Species:Danio rerio


Alignment Length:230 Identity:57/230 - (24%)
Similarity:81/230 - (35%) Gaps:97/230 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYKEDTSPEPKRRSVEEK 65
            |.||.|||.||.|||:| |||.    .||.||||||:|||:                        
Zfish     1 MPLPPALLARLAKRGIV-KQSD----HEAEEEIIAEDYDDN------------------------ 36

  Fly    66 FWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLYCVNKFNSSPLSQPSHRYLKRYKRLLRKYPL 130
                        |..|...::                       .|.||:               
Zfish    37 ------------NVDYEATRI-----------------------ESLPSN--------------- 51

  Fly   131 EAGWKDVYDKGCKAFYFYNSTTQTVSWLPPSHPKARITNSAAVFRRQLANSNDEFNFDTNMVQPK 195
               |..|:|..|...|::|..|..||||.|:.|.|.||.:|...:.:..:...:.:::      |
Zfish    52 ---WYKVFDSACGLPYYWNVETDLVSWLSPNDPAAVITKAAKKPKGETGHEKGDGHYE------K 107

  Fly   196 SSNQNEPDEPDVFVPAKKQKSRDLERKIQRRRRND 230
            :....:.|         :::.||.||..:|.|..|
Zfish   108 TERDRDRD---------RERDRDRERDRERDRDRD 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PQBP1NP_651331.1 WW 130..160 CDD:278809 11/29 (38%)
pqbp1NP_001002435.1 WW 47..78 CDD:197736 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3427
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5139
OMA 1 1.010 - - QHG48631
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106865
Panther 1 1.100 - - LDO PTHR21737
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10618
SonicParanoid 1 1.000 - - X4933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.