DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PQBP1 and cactin

DIOPT Version :9

Sequence 1:NP_651331.1 Gene:PQBP1 / 43004 FlyBaseID:FBgn0039270 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_523422.4 Gene:cactin / 33043 FlyBaseID:FBgn0031114 Length:720 Species:Drosophila melanogaster


Alignment Length:231 Identity:47/231 - (20%)
Similarity:72/231 - (31%) Gaps:101/231 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYKEDTSPEPK--RRSVEEKF 66
            |..|||.|:.|.||.::                    |.:......|...:||.|  ||..|::.
  Fly   105 PMKLLQTLEARRLVEQK--------------------DRQRKKEELKAHETPEEKRARRLREKQA 149

  Fly    67 WSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLYCVNKFNSSPLSQPSHRYLKRYKRLLRKYPLE 131
            ...|.:||:|.:..|..|.   |:           .|.|..|.|:...|                
  Fly   150 KEQRRRERMGWDNEYQTYS---NE-----------DNPFGDSNLTSTFH---------------- 184

  Fly   132 AGW-KDVYDKGCKAFYFYNSTTQTVSWLPPSHPKARITNSAAVFRRQLANSNDEFNFDTNMVQPK 195
              | |.:..:|..     |.:|:||..|.              .::||.|..:            
  Fly   185 --WGKKLEVEGLS-----NLSTKTVEVLS--------------LQKQLENRRE------------ 216

  Fly   196 SSNQNEPDEPDVFVPAKKQKSRDLERKIQRRRRNDN 231
                           .:|.|.|..||:::|:.|.|:
  Fly   217 ---------------LEKVKKRRQERELERQVREDD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PQBP1NP_651331.1 WW 130..160 CDD:278809 8/30 (27%)
cactinNP_523422.4 Endonuc_Holl 202..>274 CDD:295105 13/77 (17%)
Cactin_mid 243..432 CDD:287304
CactinC_cactus 598..720 CDD:286775
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21737
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.