DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PQBP1 and Pqbp1

DIOPT Version :9

Sequence 1:NP_651331.1 Gene:PQBP1 / 43004 FlyBaseID:FBgn0039270 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001013979.2 Gene:Pqbp1 / 302557 RGDID:1549750 Length:263 Species:Rattus norvegicus


Alignment Length:238 Identity:59/238 - (24%)
Similarity:78/238 - (32%) Gaps:90/238 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYKEDTSPEPKRRSVEEK 65
            |.||.||..||.|||::....     .|..||||||:||||    |..|:               
  Rat     1 MPLPVALQTRLAKRGILKHLE-----PEPEEEIIAEDYDDD----PVDYE--------------- 41

  Fly    66 FWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLYCVNKFNSSPLSQPSHRYLKRYKRLLRKYPL 130
              :.||:                                                        .|
  Rat    42 --ATRIE--------------------------------------------------------GL 48

  Fly   131 EAGWKDVYDKGCKAFYFYNSTTQTVSWLPPSHPKARITNSAAVFRRQLANSNDEFNFDTNMV--- 192
            ...|..|:|..|...|::|..|..||||.|..|...::.||...|...|::.|:...:...|   
  Rat    49 PPSWYKVFDPSCGLPYYWNVETDLVSWLSPHDPNFVVSKSAKKLRNSNADAEDKSERNLEKVDRN 113

  Fly   193 QPKSSNQNE-PDEPDVFVPAKKQKS-RDLER---KIQRRRRND 230
            ..||...:| ||..........:|| |:.||   |:.|.|..|
  Rat   114 HEKSDRSHEKPDRSHEKADRNHEKSDRERERNYDKVDRERDRD 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PQBP1NP_651331.1 WW 130..160 CDD:278809 12/29 (41%)
Pqbp1NP_001013979.2 WW 47..78 CDD:197736 12/30 (40%)
Disordered. /evidence=ECO:0000250|UniProtKB:O60828 94..263 17/63 (27%)
5 X 7 AA approximate tandem repeats of D-R-[NS]-H-E-K-S 104..138 6/33 (18%)
3 X 2 AA tandem repeats of [DE]-R 139..144 1/4 (25%)
6 X 2 AA tandem repeats of [DE]-R 150..161 3/7 (43%)
Important for interaction with TXNL4A. /evidence=ECO:0000250|UniProtKB:O60828 243..253
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5111
OMA 1 1.010 - - QHG48631
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106865
Panther 1 1.100 - - LDO PTHR21737
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.