DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PQBP1 and Leo1

DIOPT Version :9

Sequence 1:NP_651331.1 Gene:PQBP1 / 43004 FlyBaseID:FBgn0039270 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001034611.1 Gene:Leo1 / 235497 MGIID:2685031 Length:667 Species:Mus musculus


Alignment Length:63 Identity:19/63 - (30%)
Similarity:32/63 - (50%) Gaps:8/63 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RRQLA-----NSNDEFNFDTNMVQPKSSNQNEPDEPDVFVPAKKQKSRDLERKI--QRRRRND 230
            |:||:     ||:||....::..:.| .|.::.|:|.|....|.|.|.|...::  :..||:|
Mouse   202 RQQLSEEEKGNSDDEHPVASDNDEEK-QNSDDEDQPQVSDEEKMQNSDDERPQVSDEDGRRSD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PQBP1NP_651331.1 WW 130..160 CDD:278809
Leo1NP_001034611.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..362 19/63 (30%)
PHA02664 <61..209 CDD:177447 3/6 (50%)
Leo1 375..533 CDD:281933
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 548..585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 602..667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.