powered by:
Protein Alignment PQBP1 and Leo1
DIOPT Version :9
Sequence 1: | NP_651331.1 |
Gene: | PQBP1 / 43004 |
FlyBaseID: | FBgn0039270 |
Length: | 231 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001034611.1 |
Gene: | Leo1 / 235497 |
MGIID: | 2685031 |
Length: | 667 |
Species: | Mus musculus |
Alignment Length: | 63 |
Identity: | 19/63 - (30%) |
Similarity: | 32/63 - (50%) |
Gaps: | 8/63 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 175 RRQLA-----NSNDEFNFDTNMVQPKSSNQNEPDEPDVFVPAKKQKSRDLERKI--QRRRRND 230
|:||: ||:||....::..:.| .|.::.|:|.|....|.|.|.|...:: :..||:|
Mouse 202 RQQLSEEEKGNSDDEHPVASDNDEEK-QNSDDEDQPQVSDEEKMQNSDDERPQVSDEDGRRSD 263
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.